Anti-CDKN2A/p16INK4aF Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8379-100
Article Name: Anti-CDKN2A/p16INK4aF Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8379-100
Supplier Catalog Number: A8379-100
Alternative Catalog Number: ABC-A8379-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-156 of human CDKN2A/p16INK4a (NP_000068.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CDKN2A/p16INK4aF.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 16 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: QVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Target: CDKN2A/p16INK4aF
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200