Anti-KIR3DL3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8518-100
Artikelname: Anti-KIR3DL3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8518-100
Hersteller Artikelnummer: A8518-100
Alternativnummer: ABC-A8518-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-322 of human KIR3DL3 (NP_703144.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to KIR3DL3.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANF
Target-Kategorie: KIR3DL3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200