Anti-KIR3DL3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8518-100
Article Name: Anti-KIR3DL3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8518-100
Supplier Catalog Number: A8518-100
Alternative Catalog Number: ABC-A8518-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-322 of human KIR3DL3 (NP_703144.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to KIR3DL3.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 45 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANF
Target: KIR3DL3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200