Anti-CYP7A1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8675-100
Artikelname: Anti-CYP7A1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8675-100
Hersteller Artikelnummer: A8675-100
Alternativnummer: ABC-A8675-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 390-504 of human CYP7A1 (NP_000771.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CYP7A1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 58 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: YPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILPPLNDIEFKYKFKHL
Target-Kategorie: CYP7A1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200