Anti-CYP7A1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8675-100
Article Name: Anti-CYP7A1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8675-100
Supplier Catalog Number: A8675-100
Alternative Catalog Number: ABC-A8675-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 390-504 of human CYP7A1 (NP_000771.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CYP7A1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 58 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: YPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILPPLNDIEFKYKFKHL
Target: CYP7A1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200