Anti-POLRMT Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88198-100
Artikelname: Anti-POLRMT Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88198-100
Hersteller Artikelnummer: A88198-100
Alternativnummer: ABC-A88198-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IP, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human POLRMT (NP_005026.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to POLRMT.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 139 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: SSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF
Target-Kategorie: POLRMT
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, IP: 1:50-1:100