Anti-POLRMT Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88198-100
Article Name: Anti-POLRMT Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88198-100
Supplier Catalog Number: A88198-100
Alternative Catalog Number: ABC-A88198-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IP, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human POLRMT (NP_005026.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to POLRMT.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 139 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: SSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF
Target: POLRMT
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, IP: 1:50-1:100