Anti-RPL26 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88725-100
Artikelname: Anti-RPL26 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88725-100
Hersteller Artikelnummer: A88725-100
Alternativnummer: ABC-A88725-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 20-95 of human RPL26.
Konjugation: Unconjugated
Rabbit polyclonal antibody to RPL26.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 20 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Formulierung: Liquid
Sequenz: NAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTV
Target-Kategorie: RPL26
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, ELISA: 1 µg/ml (starting concentration)