Anti-RPL26 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88725-100
Article Name: Anti-RPL26 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88725-100
Supplier Catalog Number: A88725-100
Alternative Catalog Number: ABC-A88725-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 20-95 of human RPL26.
Conjugation: Unconjugated
Rabbit polyclonal antibody to RPL26.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 20 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Form: Liquid
Sequence: NAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTV
Target: RPL26
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, ELISA: 1 µg/ml (starting concentration)