Anti-KIR2DL3 Antibody - Identical to Abcam (ab180803), Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8958-100
Artikelname: Anti-KIR2DL3 Antibody - Identical to Abcam (ab180803), Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8958-100
Hersteller Artikelnummer: A8958-100
Alternativnummer: ABC-A8958-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3 (NP_056952.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to KIR2DL3.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Target-Kategorie: KIR2DL3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200