Anti-KIR2DL3 Antibody - Identical to Abcam (ab180803), Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8958-100
Article Name: Anti-KIR2DL3 Antibody - Identical to Abcam (ab180803), Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8958-100
Supplier Catalog Number: A8958-100
Alternative Catalog Number: ABC-A8958-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3 (NP_056952.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to KIR2DL3.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 45 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Target: KIR2DL3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200