Anti-Phosphatidic acid phosphatase type 2B Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89590-100
Artikelname: Anti-Phosphatidic acid phosphatase type 2B Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89590-100
Hersteller Artikelnummer: A89590-100
Alternativnummer: ABC-A89590-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PPAP2B (NP_003704.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Phosphatidic acid phosphatase type 2B.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 35 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI
Target-Kategorie: Phosphatidic acid phosphatase type 2B
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:100-1:200