Anti-Phosphatidic acid phosphatase type 2B Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89590-100
Article Name: Anti-Phosphatidic acid phosphatase type 2B Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89590-100
Supplier Catalog Number: A89590-100
Alternative Catalog Number: ABC-A89590-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PPAP2B (NP_003704.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Phosphatidic acid phosphatase type 2B.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 35 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI
Target: Phosphatidic acid phosphatase type 2B
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:100-1:200