Anti-U2AF35/U2AF1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89592-100
Artikelname: Anti-U2AF35/U2AF1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89592-100
Hersteller Artikelnummer: A89592-100
Alternativnummer: ABC-A89592-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to U2AF35/U2AF1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
Target-Kategorie: U2AF35/U2AF1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:100-1:200, IP: 1:500-1:1,000