Anti-U2AF35/U2AF1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89592-100
Article Name: Anti-U2AF35/U2AF1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89592-100
Supplier Catalog Number: A89592-100
Alternative Catalog Number: ABC-A89592-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to U2AF35/U2AF1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
Target: U2AF35/U2AF1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:100-1:200, IP: 1:500-1:1,000