Anti-SCD5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89651-100
Artikelname: Anti-SCD5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89651-100
Hersteller Artikelnummer: A89651-100
Alternativnummer: ABC-A89651-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, ICC, WB
Spezies Reaktivität: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-75 of human SCD5.
Konjugation: Unconjugated
Rabbit polyclonal antibody to SCD5.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.09% Sodium Azide.
Formulierung: Liquid
Sequenz: MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKAKPLTL
Target-Kategorie: SCD5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:100-1:500, ELISA: 1 µg/ml (starting concentration)