Anti-SCD5 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89651-100
Article Name: Anti-SCD5 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89651-100
Supplier Catalog Number: A89651-100
Alternative Catalog Number: ABC-A89651-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, ICC, WB
Species Reactivity: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-75 of human SCD5.
Conjugation: Unconjugated
Rabbit polyclonal antibody to SCD5.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.09% Sodium Azide.
Form: Liquid
Sequence: MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKAKPLTL
Target: SCD5
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:100-1:500, ELISA: 1 µg/ml (starting concentration)