Anti-NGF Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92198-100
Artikelname: Anti-NGF Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92198-100
Hersteller Artikelnummer: A92198-100
Alternativnummer: ABC-A92198-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 122-241 of human NGF (NP_002497.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NGF.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 27 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Target-Kategorie: NGF
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000