Anti-NGF Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92198-100
Article Name: Anti-NGF Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92198-100
Supplier Catalog Number: A92198-100
Alternative Catalog Number: ABC-A92198-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 122-241 of human NGF (NP_002497.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to NGF.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 27 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Target: NGF
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000