Anti-TRMT2B Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9221-100
Artikelname: Anti-TRMT2B Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9221-100
Hersteller Artikelnummer: A9221-100
Alternativnummer: ABC-A9221-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 1-250 of human TRMT2B.
Konjugation: Unconjugated
Rabbit polyclonal antibody to TRMT2B.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAGLKRRVPLHSLRYFISMVGLFSKPGLLPWYARNPPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLADVVTPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKL
Target-Kategorie: TRMT2B
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:2,000, IHC-P: 1:50-1:200