Anti-TRMT2B Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9221-100
Article Name: Anti-TRMT2B Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9221-100
Supplier Catalog Number: A9221-100
Alternative Catalog Number: ABC-A9221-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 1-250 of human TRMT2B.
Conjugation: Unconjugated
Rabbit polyclonal antibody to TRMT2B.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 45 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MAGLKRRVPLHSLRYFISMVGLFSKPGLLPWYARNPPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLADVVTPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKL
Target: TRMT2B
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:2,000, IHC-P: 1:50-1:200