Anti-Apo-D Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92257-100
Artikelname: Anti-Apo-D Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92257-100
Hersteller Artikelnummer: A92257-100
Alternativnummer: ABC-A92257-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-189 of human APOD (NP_001638.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Apo-D.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS
Target-Kategorie: Apo-D
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:25-1:100