Anti-Apo-D Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A92257-100
| Article Name: |
Anti-Apo-D Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A92257-100 |
| Supplier Catalog Number: |
A92257-100 |
| Alternative Catalog Number: |
ABC-A92257-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 21-189 of human APOD (NP_001638.1). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Apo-D. |
| Clonality: |
Polyclonal |
| Concentration: |
Lot Specific |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Form: |
Liquid |
| Sequence: |
QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS |
| Target: |
Apo-D |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
IHC: 1:25-1:100 |
