Anti-GPCR GPR125 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92391-100
Artikelname: Anti-GPCR GPR125 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92391-100
Hersteller Artikelnummer: A92391-100
Alternativnummer: ABC-A92391-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 370-600 of human ADGRA3 (NP_660333.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GPCR GPR125.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 146 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVFQKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSL
Target-Kategorie: GPCR GPR125
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000