Anti-GPCR GPR125 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92391-100
Article Name: Anti-GPCR GPR125 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92391-100
Supplier Catalog Number: A92391-100
Alternative Catalog Number: ABC-A92391-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 370-600 of human ADGRA3 (NP_660333.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to GPCR GPR125.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 146 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: ITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVFQKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSL
Target: GPCR GPR125
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000