Anti-JHDM1D Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92411-100
Artikelname: Anti-JHDM1D Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92411-100
Hersteller Artikelnummer: A92411-100
Alternativnummer: ABC-A92411-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 100-200 of mouse JHDM1D.
Konjugation: Unconjugated
Rabbit polyclonal antibody to JHDM1D.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 106 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: WHRHDYTEVDDGSKPVQAGTRAFVKELRSRVFPSADEIIVKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPAFSVMDVERYVGGDKVIDVIDVARQ
Target-Kategorie: JHDM1D
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000