Anti-JHDM1D Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92411-100
Article Name: Anti-JHDM1D Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92411-100
Supplier Catalog Number: A92411-100
Alternative Catalog Number: ABC-A92411-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 100-200 of mouse JHDM1D.
Conjugation: Unconjugated
Rabbit polyclonal antibody to JHDM1D.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 106 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: WHRHDYTEVDDGSKPVQAGTRAFVKELRSRVFPSADEIIVKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPAFSVMDVERYVGGDKVIDVIDVARQ
Target: JHDM1D
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000