Anti-iNOS Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92438-100
Artikelname: Anti-iNOS Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92438-100
Hersteller Artikelnummer: A92438-100
Alternativnummer: ABC-A92438-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human iNOS (NP_000616.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to iNOS.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 130 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVT
Target-Kategorie: iNOS
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:50-1:200, ICC/IF: 1:50-1:200