Anti-iNOS Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A92438-100
| Article Name: |
Anti-iNOS Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A92438-100 |
| Supplier Catalog Number: |
A92438-100 |
| Alternative Catalog Number: |
ABC-A92438-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC, IHC |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human iNOS (NP_000616.3). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to iNOS. |
| Clonality: |
Polyclonal |
| Concentration: |
Lot Specific |
| Molecular Weight: |
130 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVT |
| Target: |
iNOS |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
IHC: 1:50-1:200, ICC/IF: 1:50-1:200 |
