Anti-ARL4A Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92537-100
Artikelname: Anti-ARL4A Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92537-100
Hersteller Artikelnummer: A92537-100
Alternativnummer: ABC-A92537-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 121-200 of human ARL4A (NP_001032241.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ARL4A.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR
Target-Kategorie: ARL4A
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:50-1:200, ICC/IF: 1:50-1:200