Anti-ARL4A Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92537-100
Article Name: Anti-ARL4A Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92537-100
Supplier Catalog Number: A92537-100
Alternative Catalog Number: ABC-A92537-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 121-200 of human ARL4A (NP_001032241.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ARL4A.
Clonality: Polyclonal
Concentration: Lot Specific
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: ISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR
Target: ARL4A
Antibody Type: Primary Antibody
Application Dilute: IHC: 1:50-1:200, ICC/IF: 1:50-1:200