NKp30 Stable Cell Line Preis auf Anfrage

Artikelnummer: ABI-14-511ACL
Artikelname: NKp30 Stable Cell Line Preis auf Anfrage
Artikelnummer: ABI-14-511ACL
Hersteller Artikelnummer: 14-511ACL
Alternativnummer: ABI-14-511ACL-1VIAL
Hersteller: Abeomics
Kategorie: Zellen/Zellkultur
Applikation: FA
NKp30 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human activating Natural Killer cell receptor 30 (NKp30, also known as Natural Cytotoxicity triggering Receptor 3 (NCR3) or CD337). Sequence data: hNKp30 (accession number NP_667341) MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEV VPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTG NGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVV PAPLPPPCGSSAHLLPPVPGG
Application Verdünnung: Applicatio: Screen for antibodies of human NKp30 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1%