NKp30 Stable Cell Line Preis auf Anfrage

Catalog Number: ABI-14-511ACL
Article Name: NKp30 Stable Cell Line Preis auf Anfrage
Biozol Catalog Number: ABI-14-511ACL
Supplier Catalog Number: 14-511ACL
Alternative Catalog Number: ABI-14-511ACL-1VIAL
Manufacturer: Abeomics
Category: Zellen/Zellkultur
Application: FA
NKp30 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human activating Natural Killer cell receptor 30 (NKp30, also known as Natural Cytotoxicity triggering Receptor 3 (NCR3) or CD337). Sequence data: hNKp30 (accession number NP_667341) MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEV VPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTG NGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVV PAPLPPPCGSSAHLLPPVPGG
Application Dilute: Applicatio: Screen for antibodies of human NKp30 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1%