Anti-FABP4 Polyclonal Antibody, Rabbit

Artikelnummer: ABI-39-2008
Artikelname: Anti-FABP4 Polyclonal Antibody, Rabbit
Artikelnummer: ABI-39-2008
Hersteller Artikelnummer: 39-2008
Alternativnummer: ABI-39-2008-100UG/VIAL
Hersteller: Abeomics
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related Mouse and Rat sequences.
Alternative Synonym: Fatty acid-binding protein, adipocyte, Adipocyte lipid-binding protein, ALBP, Adipocyte-type fatty acid-binding protein, A-FABP, AFABP, Fatty acid-binding protein 4, FABP4
Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.
Klonalität: Polyclonal
NCBI: 2167
UniProt: P15090
Reinheit: Immunogen affinity purified.
Formulierung: Lyophilized
Target-Kategorie: Fatty acid-binding protein, adipocyte
Application Verdünnung: Western blot : 0.1-0.5µg/ml, Immunohistochemistry(Paraffin-embedded Section) : 0.5-1µg/ml