Anti-FABP4 Polyclonal Antibody, Rabbit

Produktübersicht

• Artikelname: Anti-FABP4 Polyclonal Antibody, Rabbit
• Artikelnummer: ABI-39-2008
• Hersteller Artikelnummer: 39-2008
• Alternativnummer: ABI-39-2008-100UG/VIAL
• Hersteller: Abeomics
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related Mouse and Rat sequences.
• Alternative Synonym: Fatty acid-binding protein, adipocyte, Adipocyte lipid-binding protein, ALBP, Adipocyte-type fatty acid-binding protein, A-FABP, AFABP, Fatty acid-binding protein 4, FABP4

Produktbeschreibung

Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 2167
• UniProt: P15090
• Reinheit: Immunogen affinity purified.
• Formulierung: Lyophilized
• Target-Kategorie: Fatty acid-binding protein, adipocyte
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Application Verdünnung: Western blot : 0.1-0.5µg/ml, Immunohistochemistry(Paraffin-embedded Section) : 0.5-1µg/ml