A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related Mouse and Rat sequences.
Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.