Anti-FABP4 Polyclonal Antibody, Rabbit

Product Overview

• Article Name: Anti-FABP4 Polyclonal Antibody, Rabbit
• Biozol Catalog Number: ABI-39-2008
• Supplier Catalog Number: 39-2008
• Alternative Catalog Number: ABI-39-2008-100UG/VIAL
• Manufacturer: Abeomics
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related Mouse and Rat sequences.
• Alternative Names: Fatty acid-binding protein, adipocyte, Adipocyte lipid-binding protein, ALBP, Adipocyte-type fatty acid-binding protein, A-FABP, AFABP, Fatty acid-binding protein 4, FABP4

Product Description

Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes

Product Properties

• Clonality: Polyclonal
• NCBI: 2167
• UniProt: P15090
• Purity: Immunogen affinity purified.
• Form: Lyophilized
• Target: Fatty acid-binding protein, adipocyte
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Dilute: Western blot : 0.1-0.5µg/ml, Immunohistochemistry(Paraffin-embedded Section) : 0.5-1µg/ml