Anti-Wnt7a Polyclonal Antibody, Rabbit

Produktübersicht

• Artikelname: Anti-Wnt7a Polyclonal Antibody, Rabbit
• Artikelnummer: ABI-39-2011
• Hersteller Artikelnummer: 39-2011
• Alternativnummer: ABI-39-2011-100UG/VIAL
• Hersteller: Abeomics
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of Human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related Mouse sequence.
• Alternative Synonym: Protein Wnt-7a, WNT7A

Produktbeschreibung

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fa

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 7476
• UniProt: O00755
• Reinheit: Immunogen affinity purified.
• Formulierung: Lyophilized
• Target-Kategorie: Protein Wnt-7a
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Application Verdünnung: Western blot : 0.1-0.5µg/ml, Immunohistochemistry(Paraffin-embedded Section) : 0.5-1µg/ml