Anti-Wnt7a Polyclonal Antibody, Rabbit

Product Overview

• Article Name: Anti-Wnt7a Polyclonal Antibody, Rabbit
• Biozol Catalog Number: ABI-39-2011
• Supplier Catalog Number: 39-2011
• Alternative Catalog Number: ABI-39-2011-100UG/VIAL
• Manufacturer: Abeomics
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of Human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related Mouse sequence.
• Alternative Names: Protein Wnt-7a, WNT7A

Product Description

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fa

Product Properties

• Clonality: Polyclonal
• NCBI: 7476
• UniProt: O00755
• Purity: Immunogen affinity purified.
• Form: Lyophilized
• Target: Protein Wnt-7a
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Dilute: Western blot : 0.1-0.5µg/ml, Immunohistochemistry(Paraffin-embedded Section) : 0.5-1µg/ml