P2RY10 (Human) Recombinant Protein
Artikelnummer:
ABN-H00027334-G01
| Artikelname: |
P2RY10 (Human) Recombinant Protein |
| Artikelnummer: |
ABN-H00027334-G01 |
| Hersteller Artikelnummer: |
H00027334-G01 |
| Alternativnummer: |
ABN-H00027334-G01-2 |
| Hersteller: |
Abnova |
| Kategorie: |
Proteine/Peptide |
| Applikation: |
AP |
| Spezies Reaktivität: |
Human |
| Human P2RY10 full-length ORF (NP_055314.1) recombinant protein without tag.This product is belong to Proteoliposome (PL). |
| Tag: |
None |
| UniProt: |
27334 |
| Puffer: |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Formulierung: |
Liquid |
| Sequenz: |
MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFIC |
| Target-Kategorie: |
P2RY10 |
| Application Verdünnung: |
Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
