P2RY10 (Human) Recombinant Protein
Catalog Number:
ABN-H00027334-G01
| Article Name: |
P2RY10 (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-H00027334-G01 |
| Supplier Catalog Number: |
H00027334-G01 |
| Alternative Catalog Number: |
ABN-H00027334-G01-2 |
| Manufacturer: |
Abnova |
| Category: |
Proteine/Peptide |
| Application: |
AP |
| Species Reactivity: |
Human |
| Human P2RY10 full-length ORF (NP_055314.1) recombinant protein without tag.This product is belong to Proteoliposome (PL). |
| Tag: |
None |
| UniProt: |
27334 |
| Buffer: |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Form: |
Liquid |
| Sequence: |
MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFIC |
| Target: |
P2RY10 |
| Application Dilute: |
Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
