NAPRT1 monoclonal antibody, clone CL0665, IgG1, Clone: [CL0665], Mouse, Monoclonal

Artikelnummer: ABN-MAB15654
Artikelname: NAPRT1 monoclonal antibody, clone CL0665, IgG1, Clone: [CL0665], Mouse, Monoclonal
Artikelnummer: ABN-MAB15654
Hersteller Artikelnummer: MAB15654
Alternativnummer: ABN-MAB15654-100,ABN-MAB15654-25
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to human NAPRT1.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against partial recombinant human NAPRT1.
Klonalität: Monoclonal
Klon-Bezeichnung: [CL0665]
Isotyp: IgG1
UniProt: 93100
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Formulierung: Liquid
Sequenz: PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP
Target-Kategorie: NAPRT1
Application Verdünnung: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)Western Blot (1:500-1:1000)The optimal working dilution should be determined by the end user.