NAPRT1 monoclonal antibody, clone CL0665, IgG1, Clone: [CL0665], Mouse, Monoclonal

Product Overview

• Article Name: NAPRT1 monoclonal antibody, clone CL0665, IgG1, Clone: [CL0665], Mouse, Monoclonal
• Biozol Catalog Number: ABN-MAB15654
• Supplier Catalog Number: MAB15654
• Alternative Catalog Number: ABN-MAB15654-100,ABN-MAB15654-25
• Manufacturer: Abnova
• Host: Mouse
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein corresponding to human NAPRT1.
• Alternative Names: ABN-202409-10_Ab

Product Description

Mouse monoclonal antibody raised against partial recombinant human NAPRT1.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [CL0665]
• Isotype: IgG1
• UniProt: 93100
• Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Form: Liquid
• Sequence: PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP
• Target: NAPRT1

Application Notes

• Application Dilute: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)Western Blot (1:500-1:1000)The optimal working dilution should be determined by the end user.