USP30 monoclonal antibody, clone CL4438, IgG2a, Clone: [CL4438], Mouse, Monoclonal

Artikelnummer: ABN-MAB15709
Artikelname: USP30 monoclonal antibody, clone CL4438, IgG2a, Clone: [CL4438], Mouse, Monoclonal
Artikelnummer: ABN-MAB15709
Hersteller Artikelnummer: MAB15709
Alternativnummer: ABN-MAB15709-100
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to human USP30.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against partial recombinant human USP30.
Klonalität: Monoclonal
Klon-Bezeichnung: [CL4438]
Isotyp: IgG2a
UniProt: 84749
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Formulierung: Liquid
Sequenz: IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST
Target-Kategorie: USP30
Application Verdünnung: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)Western Blot (1:500-1:1000)The optimal working dilution should be determined by the end user.