USP30 monoclonal antibody, clone CL4438, IgG2a, Clone: [CL4438], Mouse, Monoclonal

Catalog Number: ABN-MAB15709
Article Name: USP30 monoclonal antibody, clone CL4438, IgG2a, Clone: [CL4438], Mouse, Monoclonal
Biozol Catalog Number: ABN-MAB15709
Supplier Catalog Number: MAB15709
Alternative Catalog Number: ABN-MAB15709-100
Manufacturer: Abnova
Host: Mouse
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to human USP30.
Alternative Names: ABN-202409-10_Ab
Mouse monoclonal antibody raised against partial recombinant human USP30.
Clonality: Monoclonal
Clone Designation: [CL4438]
Isotype: IgG2a
UniProt: 84749
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Form: Liquid
Sequence: IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST
Target: USP30
Application Dilute: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)Western Blot (1:500-1:1000)The optimal working dilution should be determined by the end user.