CEACAM7 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P10970
Artikelname: CEACAM7 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P10970
Hersteller Artikelnummer: P10970
Alternativnummer: ABN-P10970-100
Hersteller: Abnova
Wirt: E. coli
Kategorie: Antikörper
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids 36-242 of human CEACAM7.
Human CEACAM7 (Q14002, 36 a.a. - 242 a.a.) full-length recombinant protein expressed in Escherichia coli.
Tag: His-SUMO tag at N-terminus
UniProt: 1087
Puffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >=90% as determined by SDS-PAGE.
Formulierung: Lyophilized
Sequenz: TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Target-Kategorie: CEACAM7
Application Verdünnung: SDS-PAGE