CEACAM7 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P10970
Article Name: CEACAM7 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P10970
Supplier Catalog Number: P10970
Alternative Catalog Number: ABN-P10970-100
Manufacturer: Abnova
Host: E. coli
Category: Antikörper
Application: SDS-PAGE
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids 36-242 of human CEACAM7.
Human CEACAM7 (Q14002, 36 a.a. - 242 a.a.) full-length recombinant protein expressed in Escherichia coli.
Tag: His-SUMO tag at N-terminus
UniProt: 1087
Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >=90% as determined by SDS-PAGE.
Form: Lyophilized
Sequence: TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Target: CEACAM7
Application Dilute: SDS-PAGE