LY6G6D(Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P10972
Artikelname: LY6G6D(Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P10972
Hersteller Artikelnummer: P10972
Alternativnummer: ABN-P10972-100
Hersteller: Abnova
Wirt: E. coli
Kategorie: Antikörper
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids 20-104 of human LY6G6D.
Human LY6G6D (O95868, 20 a.a. - 104 a.a.) full-length recombinant protein expressed in Escherichia coli.
Tag: His-B2M tag at N-terminus
UniProt: 58530
Puffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >=85% as determined by SDS-PAGE.
Formulierung: Lyophilized
Sequenz: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Target-Kategorie: LY6G6D
Application Verdünnung: SDS-PAGE