LY6G6D(Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P10972
| Article Name: |
LY6G6D(Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P10972 |
| Supplier Catalog Number: |
P10972 |
| Alternative Catalog Number: |
ABN-P10972-100 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Antikörper |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein corresponding to amino acids 20-104 of human LY6G6D. |
| Human LY6G6D (O95868, 20 a.a. - 104 a.a.) full-length recombinant protein expressed in Escherichia coli. |
| Tag: |
His-B2M tag at N-terminus |
| UniProt: |
58530 |
| Buffer: |
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity: |
>=85% as determined by SDS-PAGE. |
| Form: |
Lyophilized |
| Sequence: |
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS |
| Target: |
LY6G6D |
| Application Dilute: |
SDS-PAGE |
