TRBC2 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P10981
Artikelname: TRBC2 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P10981
Hersteller Artikelnummer: P10981
Alternativnummer: ABN-P10981-100
Hersteller: Abnova
Wirt: E. coli
Kategorie: Antikörper
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids 1-129 of human TRBC2.
Human TRBC2 (A0A5B9, 1 a.a. - 129 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag: His tag at N-terminus, Myc tag at C-terminus
UniProt: 28638
Puffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >=85% as determined by SDS-PAGE.
Formulierung: Lyophilized
Sequenz: DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Target-Kategorie: TRBC2
Application Verdünnung: SDS-PAGE