TRBC2 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P10981
Article Name: TRBC2 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P10981
Supplier Catalog Number: P10981
Alternative Catalog Number: ABN-P10981-100
Manufacturer: Abnova
Host: E. coli
Category: Antikörper
Application: SDS-PAGE
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids 1-129 of human TRBC2.
Human TRBC2 (A0A5B9, 1 a.a. - 129 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag: His tag at N-terminus, Myc tag at C-terminus
UniProt: 28638
Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >=85% as determined by SDS-PAGE.
Form: Lyophilized
Sequence: DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Target: TRBC2
Application Dilute: SDS-PAGE