CSF3 (Human) Recombinant Protein, Mammal
Artikelnummer:
ABN-P8705
- Bilder (0)
| Artikelname: | CSF3 (Human) Recombinant Protein, Mammal |
| Artikelnummer: | ABN-P8705 |
| Hersteller Artikelnummer: | P8705 |
| Alternativnummer: | ABN-P8705-2 |
| Hersteller: | Abnova |
| Wirt: | Mammal |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA |
| Spezies Reaktivität: | Human |
| Human CSF3 recombinant protein expressed in CHO cells. |
| UniProt: | 1440 |
| Puffer: | Protein (1 mg/mL) was lyophilized from a solution containing 10 mM Hydrochloric Acid, pH=6.5, 0.4 mg TWEEN-20, 100 mg mannitol, 160 mg L-arginine, 40 mg phenylalanine and 4 mg methionine. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL |
| Formulierung: | Lyophilized |
| Sequenz: | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Target-Kategorie: | CSF3 |
